PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 331aa    MW: 38391.9 Da    PI: 9.4063
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37402.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.23.9e-15120212498
                 E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
          B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                   +++ + +++ l +p +f++e ++   e+  + l  +s r W vk+  + +sg+++l+ GW +Fvk+n+Lk gD++vF  +++ + +++v +fr
  KHN37402.1 120 CAMRKTYIQRSVLFMPGNFITEDQQR--EDDHVFLWISSERAWHVKFYPSHSSGQILLSIGWMDFVKDNNLKIGDVCVFDQIKKPGISFRVVIFR 212
                 556667778888999*****988755..555799999**********55999999*************************888888888888887 PP

2B335.32.1e-112513241496
                 T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
          B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                 + +++pkkf+++h++++ +  +++l+    rsW+vkl  + ++ r  +t+G  +F ++ ++++gD++ F+l+++++f + v+v
  KHN37402.1 251 C-MYVPKKFIRSHEMDHIN--EVKLQV-GKRSWNVKL--DCYG-R--FTSGLHDFLSQCNVEAGDVCHFELIDKKKFVFEVRV 324
                 4.89*********888655..677655.77*******..6665.4..89***********************99999666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.7E-19110213IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-18111212IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.03117214IPR003340B3 DNA binding domain
PROSITE profilePS5086313.563117214IPR003340B3 DNA binding domain
PfamPF023626.5E-12118212IPR003340B3 DNA binding domain
CDDcd100171.19E-11150212No hitNo description
SMARTSM010197.7E-7239326IPR003340B3 DNA binding domain
CDDcd100173.53E-9240326No hitNo description
Gene3DG3DSA:2.40.330.101.2E-11241324IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-11250329IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-8251323IPR003340B3 DNA binding domain
PROSITE profilePS508637.81252326IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQYPLMSETL LDGNSICQRK RAKSPFSHSP SIKKVKTNPR KEPANYPSHD VKTEPAQSQR  60
ANVELSKNFH ADDLVKAKPK KRGGRRRIMC SKSKAIQNTE SSTALERANS FRSENPFFIC  120
AMRKTYIQRS VLFMPGNFIT EDQQREDDHV FLWISSERAW HVKFYPSHSS GQILLSIGWM  180
DFVKDNNLKI GDVCVFDQIK KPGISFRVVI FRDTEESSPS KFPDSEFRRC NNEVSENDFT  240
LSISKPCQFY CMYVPKKFIR SHEMDHINEV KLQVGKRSWN VKLDCYGRFT SGLHDFLSQC  300
NVEAGDVCHF ELIDKKKFVF EVRVTRCISI D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618269.10.0PREDICTED: uncharacterized protein LOC102661616
TrEMBLA0A0B2RZU60.0A0A0B2RZU6_GLYSO; B3 domain-containing protein
STRINGGLYMA10G42787.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14649515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-12B3 family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]